<Suppliers Price>

Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt

Names

[ CAS No. ]:
11063-17-5

[ Name ]:
Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt

[Synonym ]:
Butanedioic acid, 3-methyl-2,2-diphosphono-
3-Methyl-2,2-diphosphonosuccinic acid
Porcine gastric inhibitory polypeptide
Pig gastric inhibitory polypeptide
Porcine gastric inhibitory peptide
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ

Biological Activity

[Description]:

Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism[1].

[Related Catalog]:

Research Areas >> Endocrinology
Signaling Pathways >> Protein Tyrosine Kinase/RTK >> Insulin Receptor

[References]

[1]. G W Morrow, et al. The insulinotropic region of gastric inhibitory polypeptide; fragment analysis suggests the bioactive site lies between residues 19 and 30. Canadian Journal of Physiology and Pharmacology. January 1996. Volume 74.

Chemical & Physical Properties

[ Density]:
2.1±0.1 g/cm3

[ Boiling Point ]:
637.8±65.0 °C at 760 mmHg

[ Molecular Formula ]:
C5H10O10P2

[ Molecular Weight ]:
292.074

[ Flash Point ]:
339.6±34.3 °C

[ Exact Mass ]:
291.974915

[ LogP ]:
-1.90

[ Vapour Pressure ]:
0.0±4.1 mmHg at 25°C

[ Index of Refraction ]:
1.609

Related Compounds