Defensin HNP-1 human
Names
[ CAS No. ]:
99287-08-8
[ Name ]:
Defensin HNP-1 human
[Synonym ]:
HNP-1, Defensin Human Neutrophil Peptide-1
ACYCRIPACIAGERRYGTCIYQGRLWAFCC(Disulfidebridge:2-30,4-19,9-29)
Biological Activity
[Description]:
[Target]
Human Endogenous Metabolite
Chemical & Physical Properties
[ Density]:
1.5±0.1 g/cm3
[ Molecular Formula ]:
C150H228N44O38S6
[ Molecular Weight ]:
3442.030
[ Exact Mass ]:
3439.511475
[ LogP ]:
-8.95
[ Index of Refraction ]:
1.703
Safety Information
[ Personal Protective Equipment ]:
Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
[ RIDADR ]:
NONH for all modes of transport
Articles
Infect. Immun. 83 , 4701-9, (2015)
Chlamydia trachomatis infection in the lower genital tract can ascend to and cause pathologies in the upper genital tract, potentially leading to severe complications, such as tubal infertility. Howev...
The antimicrobial peptide LL-37 facilitates the formation of neutrophil extracellular traps.Biochem. J. 464(1) , 3-11, (2014)
NETs (neutrophil extracellular traps) have been described as a fundamental innate immune defence mechanism. During formation of NETs, the nuclear membrane is disrupted by an as-yet unknown mechanism. ...
Neutrophil serine proteinases and defensins in chronic obstructive pulmonary disease: effects on pulmonary epithelium.Eur. Respir. J. 12 , 1200-1208, (1998)
Neutrophils have the capacity to accumulate in high numbers in the lung during infection and inflammation. Because they play an important role in host defence against infection, but may also cause tis...