< Property Suppliers>

α-Endorphin

Product detail:

Published date: 2024-06-23 08:45:49

CAS number: 59004-96-5

Name: α-Endorphin

Price:
¥9648.0/25mg ¥3228.0/5mg ¥958.0/1mg

Purity: 97.0%

Stocking period: Inquiry

Stock: Inquiry

Supplier/Manufacture:

Name: Shanghai Jizhi Biochemical Technology Co., Ltd Recommended

Chemsrc Level: Verified

Product #: 50230

Tel: 021-57481218

Address: fengxianquwangyuannanlu1588nong1hao1710

Area: China(Mainland)

Contact: Liu jia

Contact Phone #: 18116092098

Email: 2130147988@qq.com

Website: http://www.acmec-e.com/

Detail introduction:
Shanghai Jizhi Biochemical Technology Co., Ltd. is a comprehensive reagent company dedicated to the research and development and sales of biochemical reagents and life sciences products. “Let every experimenter enjoy the fun of experimental success” is our company's vision.

The company is formed by industry veterans, with independent research and development, production, quality inspection, sales, warehouse, office base, attracting outstanding talents from domestic first-class universities and well-known scientific research institutions, with good professional background and practical experience, and huge data network. The system maintains close contact with advanced scientific research institutions at home and abroad and ranks among the international leaders.

The company is headquartered in Shanghai, China, and has a large logistics warehouse in Shanghai and Hebei. The number of goods is up to 40,000. Adopting modern warehousing and advanced logistics system can ensure the safe, rapid and timely delivery of reagents to customers. .

Since its inception, the company has always regarded product quality as the core of the company's participation in market competition. It is this successful positioning and strong product quality awareness that makes us a professional chemical reagent supplier.
The company has established a strict quality inspection system based on product quality requirements. The company strictly controls and manages all aspects related to product quality, establishes scientific inspection standards, and quantifies the inspection indicators. The responsibility is to ensure that the company maintains stable and qualified products.
The company strictly controls raw materials, all materials must comply with national standards, and establish strict product process indicators.
The company has regular employee quality training, explains new knowledge and new information in quality management, establishes the quality awareness of each employee, regulates their behavior, and strives for excellence. The quality inspection department has established standardized inspection procedures, with advanced and perfect testing equipment and means, and strictly in accordance with the regulations.
Actively listen to customer needs; carefully build product quality; provide satisfactory service in good faith; always remember that customer service is the only reason we exist.
We continue to innovate around the needs of our customers and openly collaborate with our partners. We are committed to providing researchers with competitive, comprehensive solutions and services that continuously enhance the customer experience and create maximum value for our customers.

Entrepreneurship is a feeling, ACMEC is a brand, Kyrgyzstan is a belief, we are extremely extreme.

Top suppliers:

Name: Shanghai Nianxing Industrial Co., Ltd

Area: China

Price:
¥9648.0/25mg ¥3228.0/5mg ¥958.0/1mg

Contact: Yang

Product Detail: α-Endorphin


Name: GL Biochem (Shanghai) Ltd.

Area: China

Price:
¥9648.0/25mg ¥3228.0/5mg ¥958.0/1mg

Contact: Jackie Yang

Product Detail: YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE


Name: Shanghai Jizhi Biochemical Technology Co., Ltd

Area: China

Price:
¥9648.0/25mg ¥3228.0/5mg ¥958.0/1mg

Contact: Liu jia

Product Detail: α-Endorphin


Name: Nanjing Peptide Biotech Ltd

Area: China

Price:
¥9648.0/25mg ¥3228.0/5mg ¥958.0/1mg

Contact: jom

Product Detail: β-Endorphin,human


Name: Taiwan Oyi peptide Co. Ltd

Area: China

Price:
¥9648.0/25mg ¥3228.0/5mg ¥958.0/1mg

Contact: Vinnie

Product Detail: α-Endorphin


Get all suppliers by the below link:

α-Endorphin suppliers

Price from the other suppliers:

2024-07-15 α-Endorphin

2018-02-15 YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

2020-04-03 β-Endorphin,human

2024-05-30 α-Endorphin

2021-02-06 alpha-Endorphin

Get all price from the following link:

α-Endorphin price