< Property Suppliers>

Corticotropin-releasing factor (human)

Product detail:

Published date: 2020-01-06 17:06:19

CAS number: 86784-80-7

Name: Corticotropin-Releasing Factor, human, rat

Price:
$Inquiry/1mg $104.0/1mg $368.0/5mg

Purity: 98.0%

Stocking period: 3 Day

Stock: In Stock

Product Webpage: https://www.dcchemicals.com/product_show-DC22488.html

Detail Product Information:
Corticotropin-releasing hormone (CRH) is a peptide hormone involved in the stress response..

Supplier/Manufacture:

Name: DC Chemicals Limited Recommended

Chemsrc Level: Verified

Product #: 34949

Tel: 58447131

Address: Jinyu Rd100, pudong

Area: China(Mainland)

Contact: Tony Cao

Contact Phone #: 13564518121

Email: sales@dcchemicals.com

Website: http://www.dcchemicals.com

Detail introduction:
D&C Chemicals provides a wide range of research chemicals and biochemicals including novel life-science reagents, reference compounds, APIs and Natural compounds for laboratory and scientific use.



D&C Chem has established a global network of thousands of customers from many research centers and Reagent companies in the USA, Europe and Japan.

We are the the official vendor of more than 500 universities and institutes including: Harvard University,Yale University,NIH/NCI, City of Hope ORG, PARTNERS ORG,John Hopkins University,Universit tsklinikum,Oxford University,Newcastle University,UNC,UCSF and many other universities and institutes. Our bioactive compounds received good feedback from our customers.





Our credo is committed to the adoption of different products, reliable quality, competitive prices and quality service to create value for customers.

Top suppliers:

Name: Shanghai Nianxing Industrial Co., Ltd

Area: China

Price:
$Inquiry/1mg $104.0/1mg $368.0/5mg

Contact: Huang

Product Detail: Corticotropin-Releasing Factor, human, rat


Name: GL Biochem (Shanghai) Ltd.

Area: China

Price:
$Inquiry/1mg $104.0/1mg $368.0/5mg

Contact: Jackie Yang

Product Detail: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2


Name: Shanghai Jizhi Biochemical Technology Co., Ltd

Area: China

Price:
$Inquiry/1mg $104.0/1mg $368.0/5mg

Contact: Liu jia

Product Detail: Corticotropin-Releasing Factor, human, rat


Name: ShangHai DC Chemicals Co.,Ltd

Area: China

Price:
$Inquiry/1mg $104.0/1mg $368.0/5mg

Contact: Tony Lai

Product Detail: Corticotropin-releasing factor (human)


Name: DC Chemicals Limited

Area: China

Price:
$Inquiry/1mg $104.0/1mg $368.0/5mg

Contact: Tony Cao

Product Detail: Corticotropin-releasing factor (human)


Get all suppliers by the below link:

Corticotropin-Releasing Factor, human, rat suppliers

Price from the other suppliers:

2024-07-15 Corticotropin-Releasing Factor, human, rat

2018-02-05 SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2

2019-03-05 Corticotropin-Releasing Factor, human, rat

2022-11-29 Corticotropin-releasing factor (human)

2023-11-16 Corticotropin-Releasing Factor, human, rat

2021-02-06 CRF (human, rat)

Get all price from the following link:

Corticotropin-Releasing Factor, human, rat price