Published date: 2020-04-03 16:09:59
CAS number: 89453-59-8
Name: (D-Ala2)-GRF (1-29) amide (human)
Price:
¥Inquiry/10g
¥Inquiry/100g
¥Inquiry/1kg
¥Inquiry/10kg
Purity: 98.0%
Stocking period: 7 Day
Stock: In Stock
Name: Nanjing Peptide Biotech Ltd Recommended
Chemsrc Level: Verified
Product #: 5260
Tel: 025-58361106-812
Address: NO.158 Fang Shui Road,chemical industrial park, Liuhe District, NanJing,Jiangsu
Area: China(Mainland)
Contact: jom
Contact Phone #: 15150624125
Email: chenglong.fan@njpeptide.com
Website: http://www.njpeptide.com
Annual Trade Volume: 1000
Foreign Trade % of Salers: 10
Detail introduction:
Founded in 2013, Nanjing Peptide Biotechnology Co., Ltd. is located in Jiangbei New District, Nanjing, covering an area of 1,000 square meters. Technology-based enterprises.
Nanjing Peptide is also a fast-growing biotechnology company. It has provided peptide products and services to more and more pharmaceutical companies, universities, research institutes and other drug research and development institutions. We strive to be the top 2 supplier of peptide products for customers .
Nanjing Peptide has advanced facilities and equipment and a production capacity of 2,000 peptides per month, which guarantees that we can provide customers with a variety of high-quality peptide products and services quickly and accurately.
We insist on taking professional and technical talents as the core, and our professional core technical backbones have more than 8 years of experience in the peptide field. With a deep understanding of the peptide field, Nanjing Peptide has launched 1,200 catalog peptides, and it can provide 6,000 commercial peptides. Nanjing Peptide can provide our customers with the most comprehensive peptide products and services to meet your needs in peptides. Most experimental needs of the field.
Nanjing Peptide looks forward to maintaining comprehensive cooperation with you at all stages of peptide product development, providing you with all kinds of peptide services, peptide products, and reagents for peptide synthesis.
product:
Peptide products (pharmaceutical peptide intermediates, cosmetic peptides, commonly used research peptides, etc.)
Fmoc amino acid
Resin for peptide synthesis
Other peptide synthesis reagents (Boc amino acids, Z-amino acids, condensing agents, etc.)
service:
Peptide Synthesis | Peptide Customization
Antibody Preparation | Customized Antibody
Nanjing Peptide Industry, a reliable and professional supplier of peptide products around you!
Name: GL Biochem (Shanghai) Ltd.
Area: China
Price:
¥Inquiry/10g
¥Inquiry/100g
¥Inquiry/1kg
¥Inquiry/10kg
Contact: Jackie Yang
Product Detail: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Name: Nanjing Peptide Biotech Ltd
Area: China
Price:
¥Inquiry/10g
¥Inquiry/100g
¥Inquiry/1kg
¥Inquiry/10kg
Contact: jom
Product Detail: (D-Ala2)-GRF (1-29) amide (human)
Get all suppliers by the below link:
2018-02-04 YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Get all price from the following link: