< Property Suppliers>

(D-Ala2)-GRF (1-29) amide (human)

Product detail:

Published date: 2020-04-03 16:09:59

CAS number: 89453-59-8

Name: (D-Ala2)-GRF (1-29) amide (human)

Price:
¥Inquiry/10g ¥Inquiry/100g ¥Inquiry/1kg ¥Inquiry/10kg

Purity: 98.0%

Stocking period: 7 Day

Stock: In Stock

Supplier/Manufacture:

Name: Nanjing Peptide Biotech Ltd Recommended

Chemsrc Level: Verified

Product #: 5260

Tel: 025-58361106-812

Address: NO.158 Fang Shui Road,chemical industrial park, Liuhe District, NanJing,Jiangsu

Area: China(Mainland)

Contact: jom

Contact Phone #: 15150624125

Email: chenglong.fan@njpeptide.com

Website: http://www.njpeptide.com

Annual Trade Volume: 1000

Foreign Trade % of Salers: 10

Detail introduction:
Founded in 2013, Nanjing Peptide Biotechnology Co., Ltd. is located in Jiangbei New District, Nanjing, covering an area of ​​1,000 square meters. Technology-based enterprises.
 
Nanjing Peptide is also a fast-growing biotechnology company. It has provided peptide products and services to more and more pharmaceutical companies, universities, research institutes and other drug research and development institutions. We strive to be the top 2 supplier of peptide products for customers .
 
Nanjing Peptide has advanced facilities and equipment and a production capacity of 2,000 peptides per month, which guarantees that we can provide customers with a variety of high-quality peptide products and services quickly and accurately.
 
We insist on taking professional and technical talents as the core, and our professional core technical backbones have more than 8 years of experience in the peptide field. With a deep understanding of the peptide field, Nanjing Peptide has launched 1,200 catalog peptides, and it can provide 6,000 commercial peptides. Nanjing Peptide can provide our customers with the most comprehensive peptide products and services to meet your needs in peptides. Most experimental needs of the field.
 
Nanjing Peptide looks forward to maintaining comprehensive cooperation with you at all stages of peptide product development, providing you with all kinds of peptide services, peptide products, and reagents for peptide synthesis.


product:
Peptide products (pharmaceutical peptide intermediates, cosmetic peptides, commonly used research peptides, etc.)
Fmoc amino acid
Resin for peptide synthesis
Other peptide synthesis reagents (Boc amino acids, Z-amino acids, condensing agents, etc.)

service:
Peptide Synthesis | Peptide Customization
Antibody Preparation | Customized Antibody
Nanjing Peptide Industry, a reliable and professional supplier of peptide products around you!

Top suppliers:

Name: GL Biochem (Shanghai) Ltd.

Area: China

Price:
¥Inquiry/10g ¥Inquiry/100g ¥Inquiry/1kg ¥Inquiry/10kg

Contact: Jackie Yang

Product Detail: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2


Name: Nanjing Peptide Biotech Ltd

Area: China

Price:
¥Inquiry/10g ¥Inquiry/100g ¥Inquiry/1kg ¥Inquiry/10kg

Contact: jom

Product Detail: (D-Ala2)-GRF (1-29) amide (human)


Get all suppliers by the below link:

(D-Ala2)-GRF (1-29) amide (human) suppliers

Price from the other suppliers:

2018-02-04 YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2

Get all price from the following link:

(D-Ala2)-GRF (1-29) amide (human) price