< Property Suppliers>

CART(55-102)(human)

Product detail:

Published date: 2024-07-17 15:06:40

CAS number: 214050-22-3

Name: CART (55-102) (human) trifluoroacetate salt

Price:
$Inquiry/250mg $Inquiry/100mg $Inquiry/1g

Purity: 98.0%

Stocking period: 3 Day

Stock: 3

Product Webpage: https://www.dcchemicals.com/product_show-CART55-102human.html

Detail Product Information:
CART(55-102)(human) is an endogenous satiety factor with potent appetite-suppressing activity. CART(55-102)(human) is closely associated with leptin and neuropeptide Y.

Supplier/Manufacture:

Name: DC Chemicals Limited Recommended

Chemsrc Level: Verified

Product #: 34949

Tel: 58447131

Address: Jinyu Rd100, pudong

Area: China(Mainland)

Contact: Tony Cao

Contact Phone #: 13564518121

Email: sales@dcchemicals.com

Website: http://www.dcchemicals.com

Detail introduction:
D&C Chemicals provides a wide range of research chemicals and biochemicals including novel life-science reagents, reference compounds, APIs and Natural compounds for laboratory and scientific use.



D&C Chem has established a global network of thousands of customers from many research centers and Reagent companies in the USA, Europe and Japan.

We are the the official vendor of more than 500 universities and institutes including: Harvard University,Yale University,NIH/NCI, City of Hope ORG, PARTNERS ORG,John Hopkins University,Universit tsklinikum,Oxford University,Newcastle University,UNC,UCSF and many other universities and institutes. Our bioactive compounds received good feedback from our customers.





Our credo is committed to the adoption of different products, reliable quality, competitive prices and quality service to create value for customers.

Top suppliers:

Name: Shanghai Nianxing Industrial Co., Ltd

Area: China

Price:
$Inquiry/250mg $Inquiry/100mg $Inquiry/1g

Contact: Huang

Product Detail: CART (55-102) (human)


Name: GL Biochem (Shanghai) Ltd.

Area: China

Price:
$Inquiry/250mg $Inquiry/100mg $Inquiry/1g

Contact: Jackie Yang

Product Detail: VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL


Name: DC Chemicals Limited

Area: China

Price:
$Inquiry/250mg $Inquiry/100mg $Inquiry/1g

Contact: Tony Cao

Product Detail: CART(55-102)(human)


Name: Taiwan Oyi peptide Co. Ltd

Area: China

Price:
$Inquiry/250mg $Inquiry/100mg $Inquiry/1g

Contact: Vinnie

Product Detail: CART (55-102) (human) trifluoroacetate salt


Get all suppliers by the below link:

CART (55-102) (human) trifluoroacetate salt suppliers

Price from the other suppliers:

2024-07-15 CART (55-102) (human)

2018-02-20 VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL

2024-05-30 CART (55-102) (human) trifluoroacetate salt

2021-02-06 CART (55-102) (human)

Get all price from the following link:

CART (55-102) (human) trifluoroacetate salt price