< Property Suppliers>

CART (55-102) (RAT)

Product detail:

Published date: 2023-10-10 16:12:55

CAS number: 209615-79-2

Name: CART(55-102)(rat)

Price:
$Inquiry/100g $Inquiry/1kg $Inquiry/100kg $Inquiry/1000kg

Purity: 98.0%

Stocking period: Inquiry

Stock: Inquiry

Supplier/Manufacture:

Name: Dayang Chem (Hangzhou) Co., Ltd. Recommended

Chemsrc Level: Verified

Product #: 50193

Tel: +86571-88938639

Address: 9/F ,Unit 2,259# Wensan Road,Xihu District, Hangzhou zhejiang, China

Area: China(Mainland)

Contact: Ms Wang

Contact Phone #: +86-571-8893-8639

Email: enquiry@dycnchem.com

Website: http://www.dycnchem.com

Major Market: Mainly in Southeast Asia and European and American markets

Annual Trade Volume: 10 to 20 million USD

Foreign Trade % of Salers: 90%

Detail introduction:
Dayang Chem (Hangzhou) Co., Ltd., (which predecessor is Hangzhou Dayangchem Co., Ltd, established in 2000),which headquartered in Hangzhou, China, is a high-tech enterprise specialized in technical research, production, development and trade of chemical products. After the recombination with Hangzhou Dayangchem Co., Ltd in 2020, Dayang chem (Hangzhou) Co., Ltd retained the whole sales, technical and after-sales team of Hangzhou Dayangchem Co., Ltd, which will serve our customers better.

DAYANG CHEM covers whole range from small amount (gram grade) for research to big bulk for industrial production. Synthesis capacity from 1 liter to 3000 liter is available.
business serve local customers and markets around the globe
Dayangchem focus on:
-Organic compounds
-Active Pharmaceutical Ingredient(s)
-Nutritional products
-Custom synthesis
-Contract Manufacturing

Top suppliers:

Name: Shanghai Nianxing Industrial Co., Ltd

Area: China

Price:
$Inquiry/100g $Inquiry/1kg $Inquiry/100kg $Inquiry/1000kg

Contact: Yang

Product Detail: CART (55-102) (rat)


Name: GL Biochem (Shanghai) Ltd.

Area: China

Price:
$Inquiry/100g $Inquiry/1kg $Inquiry/100kg $Inquiry/1000kg

Contact: Jackie Yang

Product Detail: IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL


Name: DC Chemicals Limited

Area: China

Price:
$Inquiry/100g $Inquiry/1kg $Inquiry/100kg $Inquiry/1000kg

Contact: Tony Cao

Product Detail: CART(55-102)(rat)


Name: Dayang Chem (Hangzhou) Co., Ltd.

Area: China

Price:
$Inquiry/100g $Inquiry/1kg $Inquiry/100kg $Inquiry/1000kg

Contact: Ms Wang

Product Detail: CART (55-102) (RAT)


Name: Taiwan Oyi peptide Co. Ltd

Area: China

Price:
$Inquiry/100g $Inquiry/1kg $Inquiry/100kg $Inquiry/1000kg

Contact: Vinnie

Product Detail: CART(55-102)(rat)


Get all suppliers by the below link:

CART(55-102)(rat) suppliers

Price from the other suppliers:

2024-07-15 CART (55-102) (rat)

2018-02-20 IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL

2020-12-18 CART(55-102)(rat)

2024-05-30 CART(55-102)(rat)

2021-02-06 CART (55-102) (rat)

Get all price from the following link:

CART(55-102)(rat) price