< Property Suppliers>

Corticotropin-releasing factor (human)

Product detail:

Published date: 2024-02-08 14:12:13

CAS number: 86784-80-7

Name: Corticotropin-Releasing Factor, human, rat

Price:
¥Inquiry/1g

Purity: 98.9%

Stocking period: 1 Day

Stock: In Stock

Detail Product Information:
Corticotropin-releasing hormone (CRH) is a peptide hormone involved in the stress response..

Supplier/Manufacture:

Name: ShangHai DC Chemicals Co.,Ltd Recommended

Chemsrc Level: Verified

Product #: 14107

Tel: 58447131

Address: Pudong new area Jin Yu road 100#

Area: China(Mainland)

Contact: Tony Lai

Contact Phone #: 13564518121

Email: order@dcchemicals.com

Website: http://www.biomedgen.cn

Foreign Trade % of Salers: 20%

Detail introduction:
D&C Chemicals provides a wide range of research chemicals and biochemicals including novel life-science reagents, reference compounds, APIs and Natural compounds for laboratory and scientific use.



D&C Chem has established a global network of thousands of customers from many research centers and Reagent companies in the USA, Europe and Japan.

We are the the official vendor of more than 500 universities and institutes including: Harvard University,Yale University,NIH/NCI, City of Hope ORG, PARTNERS ORG,John Hopkins University,Universit tsklinikum,Oxford University,Newcastle University,UNC,UCSF and many other universities and institutes. Our bioactive compounds received good feedback from our customers.





Our credo is committed to the adoption of different products, reliable quality, competitive prices and quality service to create value for customers.



Terms & Conditions





In the following Terms & Conditions DC shall mean DC Chemicals Limited. The Terms & Conditions defined below shall apply to DC branded products and services and to products distributed by DC on behalf of other suppliers.

The contents of this website, such as text, graphics, images information and other material ('Content'), are protected by copyright and other intellectual property laws, and all intellectual property rights in them belong to DC, or are licensed to it.

All DC products are manufactured under non- cGMP conditions and are for labatory research use only, not for any human or veterinary use. They should be used only by technically-qualified individuals or under their direct supervision.

All text, graphics, button icons, images, (collectively, known as 'Content'), belongs exclusively to DC Chemicals Ltd. The collection, arrangement, and assemblyof all Content on this Site (the "Compilation") belongs exclusively to DC Chemicals Ltd. The Content and the Compilation are all protected by U.S. and international copyright laws. DC authorises you to use the Content on this website solely for the purpose of purchasing products from us or otherwise promoting our products but you are not permitted to use the Content in competition with DC or any DC products.

DCCHEMICALS.COM and DC Chemicals are registered trademarks. The use of any of our trademarks or service marks without our express written consent is strictly prohibited. You may not use our trademarks or service marks in connection with any product or service in any way that is likely to cause confusion. You may not use our trademarks or service marks in any manner that disparages or discredits us. You may not use any of our trademarks or service marks in meta tags without prior explicit consent.

All users of the DC Chemicals website are deemed to have accepted these Terms and Condition in their entirety.

Nothing in these terms is intended to provide any rights to third parties to enforce any term.

Top suppliers:

Name: Shanghai Nianxing Industrial Co., Ltd

Area: China

Price:
¥Inquiry/1g

Contact: Huang

Product Detail: Corticotropin-Releasing Factor, human, rat


Name: GL Biochem (Shanghai) Ltd.

Area: China

Price:
¥Inquiry/1g

Contact: Jackie Yang

Product Detail: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2


Name: Shanghai Jizhi Biochemical Technology Co., Ltd

Area: China

Price:
¥Inquiry/1g

Contact: Liu jia

Product Detail: Corticotropin-Releasing Factor, human, rat


Name: ShangHai DC Chemicals Co.,Ltd

Area: China

Price:
¥Inquiry/1g

Contact: Tony Lai

Product Detail: Corticotropin-releasing factor (human)


Name: DC Chemicals Limited

Area: China

Price:
¥Inquiry/1g

Contact: Tony Cao

Product Detail: Corticotropin-releasing factor (human)


Get all suppliers by the below link:

Corticotropin-Releasing Factor, human, rat suppliers

Price from the other suppliers:

2024-07-15 Corticotropin-Releasing Factor, human, rat

2018-02-05 SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2

2019-03-05 Corticotropin-Releasing Factor, human, rat

2020-01-06 Corticotropin-releasing factor (human)

2023-11-16 Corticotropin-Releasing Factor, human, rat

2021-02-06 CRF (human, rat)

Get all price from the following link:

Corticotropin-Releasing Factor, human, rat price