< Property Suppliers>

GRP (human)

Product detail:

Published date: 2024-05-30 16:54:21

CAS number: 93755-85-2

Name: GRP (human)

Price:
$Inquiry/1mg $Inquiry/100kg

Purity: 98.0%

Stocking period: 1 Day

Stock: Inquiry

Supplier/Manufacture:

Name: Taiwan Oyi peptide Co. Ltd Recommended

Chemsrc Level: Verified

Product #: 3706

Tel: +86-13293139565

Address: China (Zhejiang) Pilot Free Trade Zone

Area: China(Mainland)

Contact: Vinnie

Contact Phone #: +86 13293139565

Email: Jamie@api-made.com

Website: http://www.oyichem.com

Detail introduction:
Taiwan Oyi Peptide Co.Ltd Peptide has a 900m2 GMP plant workshop for polypeptide Purification equipment, freeze-drying and packaging in-line; it has established a strict quality management system, and built a GMP workshop in accordance with international standards, and a high-quality quality management team, SOP operation are strictly followed to bring out the company's effective quality assurance system.

Oyi Peptide has a 900m2 GMP plant workshop for polypeptide Purification equipment, freeze-drying and packaging in-line; it has established a strict quality management system, and built a GMP workshop in accordance with international standards, and a high-quality quality management team, SOP operation are strictly followed to bring out the company's effective quality assurance system.

It has many sets of large Solid-phase and Liquid-phase  Reactors,six sets of preparative HPLC system over 150mm, more than 20 sets of analytical HPLC system and many sets of Agilent HPLC (High Performance Liquid Chromatography, American waters HPLC, mass spectrometer.

Top-notch peptide synthesis and purification technology, built a fast and high-throughput peptide synthesis platform, several hundred thousand of peptides banks.

It can synthesize 2-120 amino acids, purity of 99% cosmetic beauty peptide, annual production capacity (lyophilized powder) more than 100 kg.

The company can satisfy the needs from different customers, provide customized services for universities and pharmaceutical research institutions, and can provide a variety of peptide modification services for customers.

Such as Isotope labeling (2H, 15N, 13C), PEG modification, disulfide bonds, KLH, BSA, OVA peptide-coupled modification; Modification of peptide such as acetylation, amination, methylation, biotin labeling, fluorescence, etc. The beauty peptides developed and produced by the company include: anti-wrinkle and anti-aging, whitening and Anti-Spot, tighten and repairing, soothing and anti-allergic, promoting hair growth, promoting hair turning black, removing eye bags and dark circles, breast enhancement and slimming and etc.

The core team of Oyi Peptide is composed of senior experts and professors with more than 20 years of experience in the R&D and production of peptides. It has first-class liquid phase synthesis and solid phase synthesis technology, as well as mature and leading separation and purification technology, we are able to provide customers with various peptide-related technical services and products such as peptides technology development, drug R&D, custom synthesis, beauty polypeptides etc.

With independent intellectual property rights——The patented technology of polypeptide separation and purification, improves the market competitiveness of products greatly, Becomes a high-quality partner of many pharmaceutical factories, research institutes, universities and multinational companies in the daily chemical industry.

Pure Peptide,Pure Life.

This is the corporate philosophy and sacred mission practiced of our Oyi Peptide, and also the goal of our contribution to society.

In accordance with the spirit of Honest and pragmatic, pioneering and innovative, improving constantly, leading Leon Biotech's higher and farther development.

Hard-earned, serve customers with quality, head-up, Create future with technology.

Top suppliers:

Name: Shanghai Nianxing Industrial Co., Ltd

Area: China

Price:
$Inquiry/1mg $Inquiry/100kg

Contact: Yang

Product Detail: GastrinReleasingPeptidehuman


Name: GL Biochem (Shanghai) Ltd.

Area: China

Price:
$Inquiry/1mg $Inquiry/100kg

Contact: Jackie Yang

Product Detail: VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2


Name: Taiwan Oyi peptide Co. Ltd

Area: China

Price:
$Inquiry/1mg $Inquiry/100kg

Contact: Vinnie

Product Detail: GRP (human)


Get all suppliers by the below link:

GRP (human) suppliers

Price from the other suppliers:

2024-07-15 GastrinReleasingPeptidehuman

2018-02-02 VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2

2020-10-28 Gastrin-Releasing Peptide, human

2021-02-06 GRP (human)

Get all price from the following link:

GRP (human) price