< Property Suppliers>

BrainNatriureticPeptide-32human

Product detail:

Published date: 2024-07-15 12:30:15

CAS number: 114471-18-0

Name: Nesiritide acetate

Price:

Purity: 98.0%

Stocking period: 10 Day

Stock: In Stock

Supplier/Manufacture:

Name: Shanghai Nianxing Industrial Co., Ltd Recommended

Chemsrc Level: Verified

Product #: 403769

Tel: 17521765436

Address: 2222 Huancheng Road, Juyuan New District, Jiading District, Shanghai

Area: China(Mainland)

Contact: Huang

Contact Phone #: 17521765436

Email: sales@echemcloud.com

Website: http://www.chemsrc.com

Top suppliers:

Name: Shanghai Nianxing Industrial Co., Ltd

Area: China

Price:

Contact: Huang

Product Detail: BrainNatriureticPeptide-32human


Name: GL Biochem (Shanghai) Ltd.

Area: China

Price:

Contact: Jackie Yang

Product Detail: BNP-32, human;SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH(Disulfidebridge:10-26)


Name: DC Chemicals Limited

Area: China

Price:

Contact: Tony Cao

Product Detail: Nesiritide Acetate


Name: Taiwan Oyi peptide Co. Ltd

Area: China

Price:

Contact: Vinnie

Product Detail:


Get all suppliers by the below link:

Nesiritide acetate suppliers

Price from the other suppliers:

2018-01-09 BNP-32, human;SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH(Disulfidebridge:10-26)

2024-07-17 Nesiritide Acetate

2024-05-30 Nesiritide acetate

2018-07-04 Nesiritide acetate

2023-11-22 Nesiritide acetate

2021-02-06 BNP (1-32), human

Get all price from the following link:

Nesiritide acetate price