Top Suppliers:I want be here

99658-04-5

99658-04-5 structure
99658-04-5 structure
  • Name: GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
  • Chemical Name: Glucagon-like Peptide 1 Amide (Human)
  • CAS Number: 99658-04-5
  • Molecular Formula: C28H35N7O2S
  • Molecular Weight: 533.688
  • Catalog: Biochemical Peptide
  • Create Date: 2018-06-10 15:03:12
  • Modify Date: 2024-01-12 17:34:30
  • GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat)) is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells[1].

Name Glucagon-like Peptide 1 Amide (Human)
Synonyms Methanesulfonamide, N-methyl-N-[[2-[[[2-[[4-(1-methyl-4-piperidinyl)phenyl]amino][1,2,4]triazolo[1,5-a]pyridin-8-yl]amino]methyl]phenyl]methyl]-
N-Methyl-N-(2-{[(2-{[4-(1-methyl-4-piperidinyl)phenyl]amino}[1,2,4]triazolo[1,5-a]pyridin-8-yl)amino]methyl}benzyl)methanesulfonamide
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Description GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat)) is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells[1].
Related Catalog
References

[1]. Schmidtler J, Schepp W, Janczewska I, et al. GLP-1-(7-36) amide, -(1-37), and -(1-36) amide: potent cAMP-dependent stimuli of rat parietal cell function. Am J Physiol. 1991;260(6 Pt 1):G940-G950.  

Density 1.3±0.1 g/cm3
Molecular Formula C28H35N7O2S
Molecular Weight 533.688
Exact Mass 533.257263
LogP 3.10
Index of Refraction 1.666
Storage condition −20°C
WGK Germany 3