Top Suppliers:I want be here



277302-47-3

277302-47-3 structure
277302-47-3 structure
  • Name: TIP-39 trifluoroacetate salt
  • Chemical Name: TIP 39
  • CAS Number: 277302-47-3
  • Molecular Formula: C202H325N61O54S
  • Molecular Weight:
  • Catalog: Signaling Pathways GPCR/G Protein Adenylate Cyclase
  • Create Date: 2018-05-23 08:00:00
  • Modify Date: 2024-01-10 15:42:45
  • TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R)[1].

Name TIP 39
Synonyms SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Description TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R)[1].
Related Catalog
References

[1]. Della Penna K, et al. Tuberoinfundibular peptide of 39 residues (TIP39): molecular structure and activity for parathyroid hormone 2 receptor. Neuropharmacology. 2003 Jan;44(1):141-53.

Molecular Formula C202H325N61O54S