Shanghai Nianxing Industrial Co., Ltd
China
Product Name: Amylin (8-37), rat
Price:
Purity: 98.0%
Stocking Period: 10 Day
Contact: Yang

138398-61-5

138398-61-5 structure

Name: Amylin (8-37) (mouse, rat)
Chemical Name: amylin (8-37) (rat)
CAS Number: 138398-61-5
Molecular Formula: C₁₄₀H₂₂₇N₄₃O₄₃
Molecular Weight: 3200.56000
Catalog: Peptides
Create Date: 2018-12-17 16:43:43
Modify Date: 2024-01-02 20:27:22
Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist.

Name	amylin (8-37) (rat)
Synonyms	Amylin (8-37) (mouse,rat) ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 H-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 diabetes associated peptide amide*fragment 8-37 R Amylin (8-37), rat

Description	Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist.
Related Catalog	Signaling Pathways >> Others >> Others Research Areas >> Metabolic Disease Peptides
Target	Amylin receptor (AMY)[1]
In Vitro	Amylin (8-37), rat (Rat amylin-(8-37)) enhances insulin action and alters lipid metabolism in normal and insulin-resistant rats. Amylin (8-37) reduces plasma insulin (P<0.001) and enhances several measures of whole body and muscle insulin sensitivity (P<0.05) in both saline- and hGH-infused rats. Amylin-(8-37) corrects hGH-induced liver insulin resistance, increases basal plasma triglycerides and lowers plasma nonesterified fatty acids in both groups, and reduces muscle triglyceride and total long-chain acyl-CoA content in saline-treated rats (P<0.05). In isolated soleus muscle, Amylin (8-37) blocks amylin-induced inhibition of glycogen synthesis but has no effect in the absence of amylin. Thus 1) hyperamylinemia accompanies insulin resistance induced by hGH infusion; 2) Amylin (8-37) increases whole body and muscle insulin sensitivity and consistently reduces basal insulin levels in normal and hGH-induced insulin resistant rats; and 3) Amylin (8-37) elicits a significant alteration of in vivo lipid metabolism[2].
References	[1]. Bower RL, et al. Amylin structure-function relationships and receptor pharmacology: implications for amylin mimetic drug development. Br J Pharmacol. 2016 Jun;173(12):1883-98. [2]. Hettiarachchi M, et al. Rat amylin-(8-37) enhances insulin action and alters lipid metabolism in normal and insulin-resistant rats. Am J Physiol. 1997 Nov;273(5 Pt 1):E859-67.

Molecular Formula	C₁₄₀H₂₂₇N₄₃O₄₃
Molecular Weight	3200.56000
Exact Mass	3198.69000
PSA	1410.59000

138398-61-5	178603-82-2
309244-90-4	1678415-03-6
1678414-88-4	178603-79-7
198277-54-2	135702-23-7
124447-81-0	155893-22-4
1158522-08-7	940364-43-2
134104-43-1	131615-57-1
6906-52-1	930439-75-1
1018584-77-4	1375289-11-4
849349-65-1	127437-46-1