134500-80-4

134500-80-4 structure
134500-80-4 structure
  • Name: Amyloid β-Protein (1-43)
  • Chemical Name: beta-amyloid (1-43)
  • CAS Number: 134500-80-4
  • Molecular Formula: C207H318N56O62S
  • Molecular Weight: 4615.211
  • Catalog: Biochemical Peptide
  • Create Date: 2018-06-30 16:29:24
  • Modify Date: 2024-01-09 17:01:35
  • Amyloid β-Peptide(1-43) human, the Human β-amyloid peptide, is minor component of neuritic plaques found in brains of patients with Alzheimer's disease.

Name beta-amyloid (1-43)
Synonyms a-beta (1-43)
daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvviat
beta-amyloid (1-43)
amyloid beta-protein (1-43)
MFCD00240623
beta-amyloid peptide [1-43], human
beta-amyloid (1-43) peptide
h-asp-ala-glu-phe-arg-his-asp-ser-gly-tyr-glu-val-his-his-gln-lys-leu-val-phe-phe-ala-glu-asp-val-gly-ser-asn-lys-gly-ala-ile-ile-gly-leu-met-val-gly-gly-val-val-ile-ala-thr-oh
h2n-d-a-e-f-r-h-d-s-g-y-e-v-h-h-q-k-l-v-f-f-a-e-d-v-g-s-n-k-g-a-i-i-g-l-m-v-g-g-v-v-i-a-t-oh
Description Amyloid β-Peptide(1-43) human, the Human β-amyloid peptide, is minor component of neuritic plaques found in brains of patients with Alzheimer's disease.
Molecular Formula C207H318N56O62S
Molecular Weight 4615.211
Exact Mass 4614.324
Storage condition −20°C
Personal Protective Equipment Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
RIDADR NONH for all modes of transport
WGK Germany 3