- Shanghai Nianxing Industrial Co., Ltd
- China
- Product Name: Gastric Inhibitory Peptide, porcine
- Price:
- Purity: 99.0%
- Stocking Period: 10 Day
- Contact: Yang
- GL Biochem (Shanghai) Ltd.
- China
- Product Name: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
- Price: $Inquiry/1g
- Purity: 98.0%
- Stocking Period: Inquiry
- Contact: Jackie Yang
- Taiwan Oyi peptide Co. Ltd
- China
- Product Name: Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt
- Price: $Inquiry/1mg $Inquiry/100kg
- Purity: 98.0%
- Stocking Period: 1 Day
- Contact: Vinnie
11063-17-5
11063-17-5 structure
- Name: Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt
- Chemical Name: Gastric Inhibitory Polypeptide (porcine)
- CAS Number: 11063-17-5
- Molecular Formula: C5H10O10P2
- Molecular Weight: 292.074
- Catalog: Signaling Pathways Protein Tyrosine Kinase/RTK Insulin Receptor
- Create Date: 2018-08-08 14:07:55
- Modify Date: 2024-01-01 19:22:43
-
Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism[1].
| Name | Gastric Inhibitory Polypeptide (porcine) |
|---|---|
| Synonyms |
Butanedioic acid, 3-methyl-2,2-diphosphono-
3-Methyl-2,2-diphosphonosuccinic acid Porcine gastric inhibitory polypeptide Pig gastric inhibitory polypeptide Porcine gastric inhibitory peptide YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ |
| Description | Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism[1]. |
|---|---|
| Related Catalog | |
| References |
| Density | 2.1±0.1 g/cm3 |
|---|---|
| Boiling Point | 637.8±65.0 °C at 760 mmHg |
| Molecular Formula | C5H10O10P2 |
| Molecular Weight | 292.074 |
| Flash Point | 339.6±34.3 °C |
| Exact Mass | 291.974915 |
| LogP | -1.90 |
| Vapour Pressure | 0.0±4.1 mmHg at 25°C |
| Index of Refraction | 1.609 |