Top Suppliers:I want be here


475221-20-6

475221-20-6 structure
475221-20-6 structure
  • Name: Nogo-66(1-40)
  • Chemical Name: Nogo-66 (1-40)
  • CAS Number: 475221-20-6
  • Molecular Formula: C118H177N35O29S
  • Molecular Weight: 4625.11000
  • Catalog: Research Areas Inflammation/Immunology
  • Create Date: 2016-03-12 21:37:47
  • Modify Date: 2024-01-07 19:34:45
  • NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition[1].

Name Nogo-66 (1-40)
Synonyms m.w. 4625.11 c206h324n56o65
nogo extracellular peptide,1-40
arg-ile-tyr-lys-gly-val-ile-gln-ala-ile-gln-lys-ser-asp-glu-gly-his-pro-phe-arg-ala-tyr-leu-glu-ser-glu-val-ala-ile-ser-glu-glu-leu-val-gln-lys-tyr-ser-asn-ser-nh2
nep1-40
ac-riykgviqaiqksdeghpfraylesevaiseelvqkysns-nh2
Description NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition[1].
Related Catalog
In Vivo NEP(1-40) (89 μg/kg, ip, 15 min and 19 h post-injury) administration further shifts distributions of microglia away from an injury-induced activated morphology towards greater proportions of rod and macrophage-like morphologies[1]. Animal Model: 74 male Sprague-Dawley rats (328-377 g)[1]. Dosage: 89 μg/kg (97.5% PBS and 2.5% DMSO). Administration: IP, 15 min and 19 h post-injury. Result: Reduced NgR function immediately post-injury. Increased number of amoeboid microglia/macrophages at 2 days post-injury
References

[1]. Jenna M Ziebell, et al. Nogo Presence Is Inversely Associated With Shifts in Cortical Microglial Morphology Following Experimental Diffuse Brain Injury. Neuroscience. 2017 Sep 17;359:209-223.

Molecular Formula C118H177N35O29S
Molecular Weight 4625.11000
Exact Mass 4622.38000
PSA 1986.84000
LogP 3.52320