CART(55-102)(rat)

Modify Date: 2024-01-09 19:06:04

CART(55-102)(rat) Structure
CART(55-102)(rat) structure
Common Name CART(55-102)(rat)
CAS Number 209615-79-2 Molecular Weight N/A
Density N/A Boiling Point N/A
Molecular Formula C226H367N65O65S7 Melting Point N/A
MSDS N/A Flash Point N/A

 Use of CART(55-102)(rat)


CART(55-102)(rat) is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) can induces anxiety and stress-related behavior[1][2].

 Names

Name CART (55-102) (rat)
Synonym More Synonyms

 CART(55-102)(rat) Biological Activity

Description CART(55-102)(rat) is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) can induces anxiety and stress-related behavior[1][2].
Related Catalog
References

[1]. H Volkoff, et al. Effects of CART Peptides on Food Consumption, Feeding and Associated Behaviors in the Goldfish, Carassius Auratus: Actions on Neuropeptide Y- And Orexin A-induced Feeding. Brain Res. 2000 Dec 22;887(1):125-33.

[2]. Shigeyuki Chaki, et al. Cocaine- And Amphetamine-Regulated Transcript Peptide Produces Anxiety-Like Behavior in Rodents. Eur J Pharmacol. 2003 Mar 7;464(1):49-54.

 Chemical & Physical Properties

Molecular Formula C226H367N65O65S7

 Synonyms

IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL(Disulfidebridge:74-94,68-86,and88-101)
H-Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH
Top Suppliers:I want be here





Get all suppliers and price by the below link:

CART(55-102)(rat) suppliers

CART(55-102)(rat) price