![]() Cecropin A structure
|
Common Name | Cecropin A | ||
---|---|---|---|---|
CAS Number | 80451-04-3 | Molecular Weight | 4003.78 | |
Density | N/A | Boiling Point | N/A | |
Molecular Formula | C184H313N53O46 | Melting Point | N/A | |
MSDS | USA | Flash Point | N/A |
Use of Cecropin ACecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity. |
Name | Cecropin A |
---|---|
Synonym | More Synonyms |
Description | Cecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity. |
---|---|
Related Catalog | |
Target |
Bacterial[2] |
In Vitro | Cecropin A shows anticancer activity. Cecropin A (10-50 μM) dose-dependently reduces the viability of HL-60 cells. Cecropin A (30 μM) promotes ROS production, causes mitochondrial membrane potential (Δψm) collapse, and generates morphological changes in nuclear chromatin in HL-60 cells. Cecropin A (30 μM) also leads to an early apoptosis and cuases caspase-independent cell death in HL-60 cells[1]. Cecropin A has cytotoxicity on gram negative bacteria, including A. baumanii (CCARM 12005, CCARM 12035, CCARM 12036, CCARM 12037) with minimal inhibitory concentration (MIC) of 0.5-1 μM. Cecropin A (25 μM) significantly blocks the expression of mTNF-α, mIL-1β, and mMIP-2 mRNA and slightly inhibited the expression of mMIP-1 mRNA in RAW264.7 cells. Cecropin A (0.1, 0.25, 0.5, 1, 2.5, 5 μM) also inhibits NO production and reduces mTNF-α cytokine levels in LPS-stimulated RAW264.7 cells, and exihibits anti-inflammatory activity[2]. |
Cell Assay | Briefly, 5 × 105 cells/mL in RPMI 1640 supplemented with 10% heat-inactivated FCS are placed onto 96-well plates. Cecropin A is added to cell cultures at a final concentration of 10, 20, 30, 40 and 50 μM and cells are incubated for 24 h at 37°C in a humidified atmosphere with 5% CO2. Then, 20 μL MTT (0.5 mg/mL) is added to each well and the plate is incubated for 4 h at 37°C. The MTT solution is removed and isopropyl alcohol containing 0.04 N hydrochloric acid is added to each well to dissolve the formazan crystal. Absorbance is determined on a spectrophotometric microplate reader at a test wavelength of 550 nm and a reference wavelength of 620 nm. The absorbance of the cells incubated in the absence of cecropin A (untreated cells) is set at 100%. Results are expressed as percentage of cell viability[1]. |
References |
Molecular Formula | C184H313N53O46 |
---|---|
Molecular Weight | 4003.78 |
Appearance of Characters | powder |
Storage condition | −20°C |
Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
---|---|
RIDADR | NONH for all modes of transport |
WGK Germany | 3 |
Lysylated phospholipids stabilize models of bacterial lipid bilayers and protect against antimicrobial peptides.
Biochim. Biophys. Acta 1838(9) , 2198-204, (2014) Aminoacylated phosphatidylglycerols are common lipids in bacterial cytoplasmic membranes. Their presence in Staphylococcus aureus has been linked to increased resistance to a number of antibacterial a... |
|
Rgn gene is required for gut cell homeostasis after ingestion of sodium dodecyl sulfate in Drosophila.
Gene 549(1) , 141-8, (2014) Resistance and resilience constitute the two complementary aspects of epithelial host defenses in Drosophila. Epithelial cell homeostasis is necessary for the recovery of damages caused by stress or i... |
|
In vitro activities of antibiotics and antimicrobial cationic peptides alone and in combination against methicillin-resistant Staphylococcus aureus biofilms.
Antimicrob. Agents Chemother. 56(12) , 6366-71, (2012) Methicillin-resistant Staphylococcus aureus (MRSA) strains are most often found as hospital- and community-acquired infections. The danger of MRSA infections results from not only the emergence of mul... |
H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 |
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 |