- Shanghai Nianxing Industrial Co., Ltd
- China
- Product Name: Parathyroid Hormone Fragment 1-34 rat >=97% (HPLC), powder
- Price:
- Purity: 95.0%
- Stocking Period: 10 Day
- Contact: Yang
- GL Biochem (Shanghai) Ltd.
- China
- Product Name: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
- Price: $Inquiry/1g
- Purity: 98.0%
- Stocking Period: Inquiry
- Contact: Jackie Yang
- DC Chemicals Limited
- China
- Product Name: Parathyroid hormone (1-34) (rat)
- Price: $Inquiry/250mg $Inquiry/100mg $Inquiry/1g
- Purity: 98.0%
- Stocking Period: 3 Day
- Contact: Tony Cao
- Nanjing Peptide Biotech Ltd
- China
- Product Name: pTH (1-34) (rat)
- Price: ￥Inquiry/10g ￥Inquiry/100g ￥Inquiry/1kg ￥Inquiry/10kg
- Purity: 98.0%
- Stocking Period: 7 Day
- Contact: jom
- Taiwan Oyi peptide Co. Ltd
- China
- Product Name: pTH (1-34) (rat)
- Price: $Inquiry/1mg $Inquiry/100kg
- Purity: 98.0%
- Stocking Period: 1 Day
- Contact: Vinnie
98614-76-7
98614-76-7 structure
- Name: pTH (1-34) (rat)
- Chemical Name: Parathyroid Hormone(1-34),Rat
- CAS Number: 98614-76-7
- Molecular Formula: C180H291N55O48S2
- Molecular Weight: 4057.71
- Catalog: Biochemical Peptide
- Create Date: 2018-09-22 13:06:20
- Modify Date: 2024-01-30 18:13:15
-
Parathyroid hormone (1-34) (rat) is a parathyroid hormone (PTH) receptor agonist, increasing serum PTH levels and bone mass in rats.
| Name | Parathyroid Hormone(1-34),Rat |
|---|---|
| Synonyms |
MFCD00149015
Rat parathyroid hormone 1-34 |
| Description | Parathyroid hormone (1-34) (rat) is a parathyroid hormone (PTH) receptor agonist, increasing serum PTH levels and bone mass in rats. |
|---|---|
| Related Catalog |
| Molecular Formula | C180H291N55O48S2 |
|---|---|
| Molecular Weight | 4057.71 |
| Appearance | powder |
| Storage condition | −20°C |
| Water Solubility | Soluble in water or 0.1% acetic acid. |
| Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
|---|---|
| RIDADR | NONH for all modes of transport |
| WGK Germany | 3 |