9015-71-8

9015-71-8 structure

Name: Corticotropin Releasing Factor (148-188), ovine
Chemical Name: Corticotropin Releasing Factor sheep
CAS Number: 9015-71-8
Molecular Formula: C₂₀₅H₃₃₉N₅₉O₆₃S
Molecular Weight: 4670.38
Catalog: Research Areas Neurological Disease
Create Date: 2018-02-06 13:14:47
Modify Date: 2024-01-02 18:54:16
Corticotropin-releasing hormone (CRH) is a peptide hormone involved in stress responses. Corticotropin-releasing factor (CRF) is a major regulatory peptide in the hypothalamic-pituitary-adrenal (HPA) axis under stress conditions. Corticotropin-releasing hormone (CRH) can be used for the research of neuroendocrine and anxiety-like behaviors[1][2].

Name	Corticotropin Releasing Factor sheep
Synonyms	SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2 Corticotropin Releasing Factor (148-188), ovine

Description	Corticotropin-releasing hormone (CRH) is a peptide hormone involved in stress responses. Corticotropin-releasing factor (CRF) is a major regulatory peptide in the hypothalamic-pituitary-adrenal (HPA) axis under stress conditions. Corticotropin-releasing hormone (CRH) can be used for the research of neuroendocrine and anxiety-like behaviors[1][2].
Related Catalog	Signaling Pathways >> Others >> Others Research Areas >> Neurological Disease

Personal Protective Equipment	Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
Hazard Codes	Xi
RIDADR	NONH for all modes of transport
WGK Germany	3.0