Name | PKC fragment (530-558) |
---|---|
Synonyms |
protein kinase c fragment 530-558
h-leu-leu-tyr-glu-met-leu-ala-gly-gln-ala-pro-phe-glu-gly-glu-asp-glu-asp-glu-leu-phe-gln-ser-ile-met-glu-his-asn-val-nh2 llyemlagqapfegededelfqsimehnv-nh2 llyemlagqapfegededelfqsimehnv Protein Kinase C (530-558) LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SER-ILE-MET-GLU-HIS-ASN-VAL-NH2 |
Description | Protein Kinase C (530-558), a peptide fragment of protein kinase C (PKC), is a potent PKC activator. Protein Kinase C (530-558) significantly inhibits osteoclastic bone resorption[1]. |
---|---|
Related Catalog | |
In Vitro | Protein Kinase C (530-558) (1 nM-1 μM, 24 h) causes a dose-responsive inhibition of bone resorption, which is accompanied by a rapid and distinctive change in osteoclast morphology[1]. Cell Viability Assay[1] Cell Line: Osteoclast cell Concentration: 1 nM, 10 nM, 100 nM, 1 μM Incubation Time: 24 h Result: Showed a dose-responsive, marked inhibition of bone resorption was observed between 10 nM and 1 μM. At 1 μM, resorption was inhibited by more thaln 87 %. |
Density | 1.4±0.1g/cm3 |
---|---|
Boiling Point | 3001.7±65.0°C at 760 mmHg |
Molecular Formula | C148H221N35O50S2 |
Molecular Weight | 3354.67000 |
Flash Point | 1769.2±34.3°C |
Exact Mass | 3352.53000 |
PSA | 1422.53000 |
LogP | 3.50500 |
Index of Refraction | 1.582 |
WGK Germany | 3 |
---|