Calcitonin (rat) trifluoroacetate salt
Modify Date: 2024-01-09 23:27:10
Calcitonin (rat) trifluoroacetate salt structure
|
Common Name | Calcitonin (rat) trifluoroacetate salt | ||
|---|---|---|---|---|
| CAS Number | 11118-25-5 | Molecular Weight | 3399.83 | |
| Density | N/A | Boiling Point | N/A | |
| Molecular Formula | C148H228N40O46S3 | Melting Point | N/A | |
| MSDS | N/A | Flash Point | N/A | |
Use of Calcitonin (rat) trifluoroacetate saltCalcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development[1]. |
| Name | Calcitonin rat |
|---|---|
| Synonym | More Synonyms |
| Description | Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development[1]. |
|---|---|
| Related Catalog | |
| References |
[1]. Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54. |
| Molecular Formula | C148H228N40O46S3 |
|---|---|
| Molecular Weight | 3399.83 |
| Exact Mass | 3397.59000 |
| PSA | 1455.73000 |
| Appearance of Characters | powder |
| Storage condition | −20°C |
| WGK Germany | 3 |
|---|---|
| HS Code | 3822009000 |
| HS Code | 3822009000 |
|---|
| CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 |
| CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-LEU-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-SER-ILE-GLY-VAL-GLY-ALA-PRO-NH2(DISULFIDE BRIDGE:CYS1-CYS7) |
- Shanghai Nianxing Industrial Co., Ltd
- China
- Product Name: Calcitoninrat
- Price: Click To Check
- Purity: 95.0%
- Delivery: 10 Day
- Contact: Yang
- Email: sales@echemcloud.com
- GL Biochem (Shanghai) Ltd.
- China
- Product Name: CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2
- Price: $Inquiry/1g
- Purity: 98.0%
- Delivery: Inquiry
- Contact: Jackie Yang
- Email: ymbetter@glbiochem.com
- Taiwan Oyi peptide Co. Ltd
- China
- Product Name: Calcitonin (rat) trifluoroacetate salt
- Price: $Inquiry/1mg $Inquiry/100kg
- Purity: 98.0%
- Delivery: 1 Day
- Contact: Vinnie
- Email: Jamie@api-made.com
Get all suppliers and price by the below link: