11118-25-5

11118-25-5 structure

Name: Calcitonin (rat) trifluoroacetate salt
Chemical Name: Calcitonin rat
CAS Number: 11118-25-5
Molecular Formula: C₁₄₈H₂₂₈N₄₀O₄₆S₃
Molecular Weight: 3399.83
Catalog: Biochemical Peptide
Create Date: 2018-06-24 20:34:09
Modify Date: 2024-01-09 23:27:10
Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development[1].

Name	Calcitonin rat
Synonyms	CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-LEU-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-SER-ILE-GLY-VAL-GLY-ALA-PRO-NH2(DISULFIDE BRIDGE:CYS1-CYS7)

Description	Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development[1].
Related Catalog	Research Areas >> Others Signaling Pathways >> Others >> Others
References	[1]. Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54.

WGK Germany	3
HS Code	3822009000

HS Code	3822009000