ACTH (7-38) (human)
ACTH (7-38) (human) structure
|
Common Name | ACTH (7-38) (human) | ||
|---|---|---|---|---|
| CAS Number | 68563-24-6 | Molecular Weight | 3659.11 | |
| Density | N/A | Boiling Point | N/A | |
| Molecular Formula | C167H257N47O46 | Melting Point | N/A | |
| MSDS | USA | Flash Point | N/A | |
Use of ACTH (7-38) (human)ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity[1]. |
| Name | ACTH (7-38) (human) |
|---|---|
| Synonym | More Synonyms |
| Description | ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity[1]. |
|---|---|
| Related Catalog | |
| References |
| Molecular Formula | C167H257N47O46 |
|---|---|
| Molecular Weight | 3659.11 |
| Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
|---|---|
| RIDADR | NONH for all modes of transport |
|
Gastric inhibitory polypeptide stimulates glucocorticoid secretion in rats, acting through specific receptors coupled with the adenylate cyclase-dependent signaling pathway.
Peptides 20(5) , 589-94, (1999) Gastric inhibitory polypeptide (GIP) is a 42-amino acid peptide, belonging to the VIP-secretin-glucagon superfamily, some members of this group are able to regulate adrenocortical function. GIP-recept... |
|
|
Evidence that an extrahypothalamic pituitary corticotropin-releasing hormone (CRH)/adrenocorticotropin (ACTH) system controls adrenal growth and secretion in rats.
Cell Tissue Res. 272(3) , 439-45, (1993) Within two weeks, hypophysectomy induced in rats a striking decrease in the level of circulating ACTH (the concentration of which was at the limit of sensitivity of our assay system), coupled with a n... |
|
|
Adrenocorticotrophic hormone modulates Escherichia coli O157:H7 adherence to porcine colonic mucosa.
Stress 8(3) , 185-90, (2005) Exposure to stress is associated with susceptibility to disease and one stress mediator, norepinephrine, has been reported to enhance the adherence of enterohemorrhagic Escherichia coli O157:H7 (EHEC)... |
| Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu |
| FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE |