- Shanghai Nianxing Industrial Co., Ltd
- China
- Product Name: GastricInhibitoryPolypeptidehuman
- Price:
- Purity: 98.0%
- Stocking Period: 10 Day
- Contact: Yang
- GL Biochem (Shanghai) Ltd.
- China
- Product Name: GIP, human
- Price: $Inquiry/1kg
- Purity: 98.0%
- Stocking Period: 14 Day
- Contact: Jackie Yang
- Taiwan Oyi peptide Co. Ltd
- China
- Product Name: Gastric Inhibitory Polypeptide (human)
- Price: $Inquiry/1mg $Inquiry/100kg
- Purity: 98.0%
- Stocking Period: 1 Day
- Contact: Vinnie
100040-31-1
100040-31-1 structure
- Name: Gastric Inhibitory Polypeptide (human)
- Chemical Name: Gastric Inhibitory Polypeptide human
- CAS Number: 100040-31-1
- Molecular Formula: C226H338N60O66S
- Molecular Weight: 4983.53
- Catalog: Peptides
- Create Date: 2018-03-23 08:00:00
- Modify Date: 2024-01-02 02:39:30
-
Gastric Inhibitory Peptide (GIP), human is thought to act as an inhibitor of gastric functions.
| Name | Gastric Inhibitory Polypeptide human |
|---|---|
| Synonyms |
MFCD00081634
GIP, human YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ Gastric Inhibitory Peptide (GIP), human |
| Description | Gastric Inhibitory Peptide (GIP), human is thought to act as an inhibitor of gastric functions. |
|---|---|
| Related Catalog | |
| In Vitro | Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state,sup>[1]. |
| References |
| Molecular Formula | C226H338N60O66S |
|---|---|
| Molecular Weight | 4983.53 |
| Storage condition | -20°C |
| Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
|---|---|
| Hazard Codes | Xn |
| RIDADR | NONH for all modes of transport |
| WGK Germany | 3.0 |